LMF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LMF2 Polyclonal antibody, PBS Only (16249-1-PBS)

• 

  WB analysis of HeLa using 16249-1-AP (same clone as 16249-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16249-1-AP (LMF2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16249-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16249-1-AP (same clone as 16249-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16249-1-AP (LMF2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16249-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16249-1-AP (same clone as 16249-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 16249-1-AP (LMF2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16249-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16249-1-AP (same clone as 16249-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 16249-1-AP (LMF2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16249-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 16249-1-AP (same clone as 16249-1-PBS)

  Immunofluorescent analysis of MCF-7 cells, using 16249-1-AP and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 16249-1-PBS in a different storage buffer formulation.

LMF2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16249-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

LMF 2, TMEM112B, TMEM153

---

Product Information

16249-1-PBS targets LMF2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9208

  Product name: Recombinant human LMF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 394-610 aa of BC014652

  Sequence: VPYSYVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGSYDGHHWTEIEFMYKPGNLSRPPPVVVPHQPRLDWQMWFAALGPHTHSPWFTSLVLRLLQGKEPVIRLVQSQVARYPFHKQPPTYVRAQRYKYWFSQPGEQGQWWRRQWVEEFFPSVSLGDPTLETLLRQFGLQEKSPPRTRSANSTLAQALHWTRSQLSPLEA

• Full Name: lipase maturation factor 2
• Calculated Molecular Weight: 682 aa, 77 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC014652
• Gene Symbol: LMF2
• Gene ID (NCBI): 91289
• RRID: AB_2136142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BU23
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.