"Lamin B1 Antibodies" Comparison
View side-by-side comparison of Lamin B1 antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | NCI-H1299 cells, multi-cells/tissue, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, 4T1cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 390 publications below |
| IHC | See 3 publications below |
| IF | See 34 publications below |
| IP | See 4 publications below |
| CoIP | See 2 publications below |
Product Information
66095-1-Ig targets Lamin B1 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, canine, chicken, zebrafish, bovine, hamster |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20522 Product name: Recombinant human Lamin B1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 237-587 aa of BC012295 Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM Predict reactive species |
| Full Name | lamin B1 |
| Calculated Molecular Weight | 66 kDa |
| Observed Molecular Weight | 66-70 kDa |
| GenBank Accession Number | BC012295 |
| Gene Symbol | Lamin B1 |
| Gene ID (NCBI) | 4001 |
| ENSEMBL Gene ID | ENSG00000113368 |
| RRID | AB_11232208 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P20700 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. This protein is not suitable for samples where the nuclear envelope has been removed.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IF protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IHC protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IP protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| WB protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Ceramide-rich microdomains facilitate nuclear envelope budding for non-conventional exosome formation. | ||
J Hepatol OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism. | ||
Cell Rep Med Management of prostate cancer by targeting 3βHSD1 after enzalutamide and abiraterone treatment. | ||
Nat Commun FOXP3+ regulatory T cell perturbation mediated by the IFNγ-STAT1-IFITM3 feedback loop is essential for anti-tumor immunity | ||
Nat Commun ARF1 prevents aberrant type I interferon induction by regulating STING activation and recycling | ||
J Clin Invest FAM117B promotes gastric cancer growth and drug resistance by targeting the KEAP1/NRF2 signaling pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Echo (Verified Customer) (10-03-2024) | Quality great
![]() |
FH PK (Verified Customer) (08-14-2024) | Excellent
![]() |
FH S (Verified Customer) (12-12-2022) |
![]() |
FH WEI (Verified Customer) (03-08-2022) | Specfic bands around predicted size with higher non-specific bands
|
FH P. (Verified Customer) (05-15-2021) | Good antibody!
![]() |
FH Eiko (Verified Customer) (11-18-2020) | Used RIPA buffer for western sample preparation, and 5% Skim milk TBS-T was used for blocking and antibody dilution.Since I could see clear lamin B1 signal, I am happy to use this antibody as one of my internal controls.
|
FH Tom (Verified Customer) (10-09-2020) | I observed a discrete ~70kDa Lamin B1 band using this antibody.
|
FH Yuan (Verified Customer) (12-13-2019) | Did staining for human A549 cell.The Lamin B antibody had high background in nucleus. Please see attached image.
![]() |
FH Shubham (Verified Customer) (03-14-2019) | good
![]() |



























