ANGPTL8/Betatrophin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ANGPTL8/Betatrophin Polyclonal antibody (23792-1-AP)

• 

  IHC staining of human liver cancer using 23792-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 23792-1-AP (ANGPTL8/Betatrophin antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver cancer using 23792-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 23792-1-AP (ANGPTL8/Betatrophin antibody at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver using 23792-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23792-1-AP (ANGPTL8/Betatrophin antibody at dilution of 1:200 (under 40x lens).

ANGPTL8/Betatrophin Polyclonal Antibody for IHC, ELISA

Cat No. 23792-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, CoIP, ELISA

Synonyms

ANGPTL8, Betatrophin, C19orf80, LOC55908, PRO1185, PVPA599, td26

---

Tested Applications

• Positive IHC detected in: human liver cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• CoIP: See 1 publications below

Product Information

23792-1-AP targets ANGPTL8/Betatrophin in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20698

  Product name: Recombinant human LOC55908 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-251 aa of BC146552

  Sequence: RNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

• Full Name: hepatocellular carcinoma-associated gene TD26
• Calculated Molecular Weight: 251 aa, 28 kDa
• GenBank Accession Number: BC146552
• Gene Symbol: ANGPTL8
• Gene ID (NCBI): 55908
• RRID: AB_2879325
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXH0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	CoIP	Cell Mol Life Sci; ANGPTL8 accelerates bone loss in diabetic mice by promoting osteoclastic differentiation and inhibiting osteoblastic differentiation through AMPK pathway-mediated metabolic reprogramming.; Authors - Peng Tuo
mouse	WB	Int J Mol Sci; Adiponectin Intervention to Regulate Betatrophin Expression, Attenuate Insulin Resistance and Enhance Glucose Metabolism in Mice and Its Response to Exercise; Authors - Qi Guo