LPAR4 Polyclonal antibody

• 

  WB analysis using 22165-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 22165-1-AP (LPAR4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 22165-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22165-1-AP (LPAR4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 22165-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 22165-1-AP (LPAR4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary using 22165-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 22165-1-AP (LPAR4 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 22165-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 22165-1-AP (LPAR4 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of SW 1990 using 22165-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SW 1990 cells using LPAR4 antibody (22165-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

LPAR4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22165-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

LPA4, LPA receptor 4, LPA 4, G-protein coupled receptor 23, GPR23

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, mouse brain tissue, HL-60 cells, 3T3-L1 cells
• Positive IHC detected in: human ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SW 1990 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

22165-1-AP targets LPAR4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17817

  Product name: Recombinant human LPAR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 311-370 aa of BC069996

  Sequence: YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

• Full Name: lysophosphatidic acid receptor 4
• Calculated Molecular Weight: 370 aa, 42 kDa
• Observed Molecular Weight: 42-50 kDa
• GenBank Accession Number: BC069996
• Gene Symbol: LPAR4
• Gene ID (NCBI): 2846
• RRID: AB_11182491
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99677
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Inhibitory effects of β-galactoside α2,6-sialyltransferase 1 on the Hippo pathway in breast cancer cells; Authors - Qinglei Hang
human	WB	Nat Cell Biol; Pancreatic cancer cells upregulate LPAR4 in response to isolation stress to promote an ECM-enriched niche and support tumour initiation; Authors - Chengsheng Wu