LPAR4 Recombinant monoclonal antibody

• 

  Affinity and Kinetic Characterization of 83457-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83457-1-RR against Human LPAR4 were performed. The affinity constant is below 1 pM.

LPAR4 Uni-rAb^® Recombinant Antibody for ELISA

Cat No. 83457-1-RR

Clone No.240079C3

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

ELISA

Synonyms

LPA receptor 4, LPA 4, G-protein coupled receptor 23, GPR23, G protein coupled receptor 23

---

Product Information

83457-1-RR targets LPAR4 in ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17817

  Product name: Recombinant human LPAR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 311-370 aa of BC069996

  Sequence: YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

• Full Name: lysophosphatidic acid receptor 4
• Calculated Molecular Weight: 370 aa, 42 kDa
• GenBank Accession Number: BC069996
• Gene Symbol: LPAR4
• Gene ID (NCBI): 2846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q99677
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.