LPPR4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LPPR4 Polyclonal antibody, PBS Only (24825-1-PBS)

• 

  WB analysis using 24825-1-AP (same clone as 24825-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24825-1-AP (LPPR4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24825-1-PBS in a different storage buffer formulation.

LPPR4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24825-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Brain-specific phosphatidic acid phosphatase-like protein 1, Inactive 2-lysophosphatidate phosphatase PLPPR4, KIAA0455, Lipid phosphate phosphatase-related protein type 4, LPR4

---

Product Information

24825-1-PBS targets LPPR4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20298

  Product name: Recombinant human LPPR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 586-755 aa of BC042963

  Sequence: KNTEGSTVSCTGSIRYKTLTDHEPSGIVRVEAHTENNRPIIQIPSTEGEGSGSWKWKAPEKGSLRQTYELNDLNRDSESCESLKDSFGSGDRKRSNIDSNEHHHHGITTIRVTPVEGSEIGSETLSISSSRDSTLRRKGNIILIPERSNSPENTRNIFYKGTSPTRAYKD

• Full Name: plasticity related gene 1
• Calculated Molecular Weight: 763 aa, 83 kDa
• Observed Molecular Weight: 83-100 kDa
• GenBank Accession Number: BC042963
• Gene Symbol: LPPR4
• Gene ID (NCBI): 9890
• RRID: AB_3669452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z2D5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.