LPXN Polyclonal antibody

• 

  WB analysis using 11307-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11307-1-AP (LPXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 11307-1-AP

  WB result of LPXN antibody (11307-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LPXN transfected PC-3 cells.

• 

  IP experiment of PC-3 using 11307-1-AP

  IP result of anti-LPXN (IP:11307-1-AP, 4ug; Detection:11307-1-AP 1:5000) with PC-3 cells lysate 1575 ug.

• 

  IF Staining of PC-3 using 11307-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using LPXN antibody (11307-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

LPXN Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 11307-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

LDPL, LDLP

---

Tested Applications

• Positive WB detected in: DU 145 cells, PC-3 cells
• Positive IP detected in: PC-3 cells
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

11307-1-AP targets LPXN in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1845

  Product name: Recombinant human LPXN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 87-386 aa of BC019035

  Sequence: TSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL

• Full Name: leupaxin
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC019035
• Gene Symbol: LPXN
• Gene ID (NCBI): 9404
• RRID: AB_2877756
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60711
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LPXN, also known as Leupaxin, LDPL, belongs to the paxillin family. LPXN Contributes to the regulation of cell adhesion, spreading, and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events (PMID: 20543562). LPXN has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of the focal adhesion kinase family (PMID: 9565592). Studies in breast cancer implicate LPXN is involved in the regulation of ER action as a co-factor (PMID: 25955236). LPXN is expressed in prostate cancer cells and its expression intensity is directly linked to PCa progression (PMID: 18451096).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	J Mol Cell Cardiol; Exogenous extracellular matrix proteins decrease cardiac fibroblast activation in stiffening microenvironment through CAPG.; Authors - Xinming Wang
mouse	IHC	Mol Cell Biochem; STAT3 mediates ECM stiffness-dependent progression in ovarian cancer; Authors - Sun Chenchen