Home
Products
Primary Antibodies
LRG1 Polyclonal antibody, PBS Only (13224-1-PBS)

Filter: AllWBIHC

WB analysis of human plasma using 13224-1-AP (same clone as 13224-1-PBS)
human plasma were subjected to SDS PAGE followed by western blot with 13224-1-AP (LRG1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13224-1-AP (LRG1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13224-1-AP (LRG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of mouse pancreas using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 13224-1-AP (LRG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of mouse prostate using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse prostate tissue slide using 13224-1-AP (LRG1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13224-1-AP (LRG1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13224-1-AP (LRG1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 13224-1-AP (LRG1 Antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 13224-1-AP (LRG1 Antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13224-1-AP (LRG1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13224-1-AP (LRG1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13224-1-AP (LRG1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 13224-1-AP (same clone as 13224-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 13224-1-AP (LRG1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13224-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

LRG1 Polyclonal antibody, PBS Only

Name: LRG1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 13224-1-PBS

LRG1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13224-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

HMFT1766, Leucine-rich alpha-2-glycoprotein, LRG

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

13224-1-PBS targets LRG1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3964 Product name: Recombinant human LRG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-347 aa of BC034389 Sequence: DCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ Predict reactive species
Full Name	leucine-rich alpha-2-glycoprotein 1
Calculated Molecular Weight	347 aa, 38 kDa
Observed Molecular Weight	45 kDa
GenBank Accession Number	BC034389
Gene Symbol	LRG1
Gene ID (NCBI)	116844
RRID	AB_2138714
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P02750
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

LRG1, also known as LRG, is a member of the leucine-rich repeat (LRR) family of proteins, containing eight LRR (leucine-rich) repeats and one LRRCT domain. The gene of LRG1 maps to chromosome 19p13.3, and encodes a 347-amino acid protein with a predicted unmodified molecular weight of 38 kD. The mature form of LRG1 is a secreted glycoprotein which has 312 amino acids and an experimentally determined molecular mass of 45 kD. The LRR family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation. Levels of the LRG protein are markedly elevated in acute appendicitis and therefore could be used as a diagnostic aid.