LRMP Polyclonal antibody

• 

  IHC staining of human tonsillitis using 24772-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24772-1-AP (LRMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 24772-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24772-1-AP (LRMP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 24772-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24772-1-AP (LRMP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human tonsillitis using 24772-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24772-1-AP (LRMP Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 24772-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 24772-1-AP (LRMP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 24772-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 24772-1-AP (LRMP Antibody) at dilution of 1:50 (under 40x lens).

LRMP Polyclonal Antibody for IHC, ELISA

Cat No. 24772-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

JAW1, LRMP, Protein Jaw1

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24772-1-AP targets LRMP in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20390

  Product name: Recombinant human LRMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 256-306 aa of BC126417

  Sequence: EVMIQHVENLKRMYAKEHAELEELKQVLLQNERSFNPLEDDDDCQIKKRSA

• Full Name: lymphoid-restricted membrane protein
• Calculated Molecular Weight: 555 aa, 62 kDa
• GenBank Accession Number: BC126417
• Gene Symbol: LRMP
• Gene ID (NCBI): 4033
• RRID: AB_2879714
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12912
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.