LRRC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRRC2 Polyclonal antibody, PBS Only (28057-1-PBS)

• 

  WB analysis using 28057-1-AP (same clone as 28057-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28057-1-AP (LRRC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28057-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 28057-1-AP (same clone as 28057-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28057-1-AP (LRRC2 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28057-1-PBS in a different storage buffer formulation.

LRRC2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28057-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28057-1-PBS targets LRRC2 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27830

  Product name: Recombinant human LRRC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-200 aa of BC029118

  Sequence: ETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFIDTSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGN

• Full Name: leucine rich repeat containing 2
• Calculated Molecular Weight: 371 aa, 43 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC029118
• Gene Symbol: LRRC2
• Gene ID (NCBI): 79442
• RRID: AB_3669639
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYS8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Leucine Rich Repeat Containing 2 (LRRC2) was found to be localized to the mitochondria in human cells and transcriptionally regulated by the mitochondrial master regulator Pgc-1α. It has been reported that Lrrc2 transcript abundance correlates with that of β-MHC, a canonical marker of cardiac hypertrophy in humans, and experimentally demonstrated an elevation in Lrrc2 transcript in vitro and in vivo rodent models of cardiac hypertrophy as well as in patients with dilated cardiomyopathy. (PMID: 28158196)