LRRC4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRRC4 Polyclonal antibody, PBS Only (24834-1-PBS)

• 

  WB analysis using 24834-1-AP (same clone as 24834-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24834-1-AP (LRRC4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24834-1-PBS in a different storage buffer formulation.

LRRC4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24834-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

UNQ554/PRO1111, NGL 2, Netrin G2 ligand, NAG14, BAG

---

Product Information

24834-1-PBS targets LRRC4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20376

  Product name: Recombinant human LRRC4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 311-520 aa of BC111561

  Sequence: LAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLD

• Full Name: leucine rich repeat containing 4
• Calculated Molecular Weight: 653 aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC111561
• Gene Symbol: LRRC4
• Gene ID (NCBI): 64101
• RRID: AB_3669453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBW1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.