CoraLite® Plus 488-conjugated LRRC50 Polyclonal antibody

• 

  IF Staining of mouse testis using CL488-30156

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using CoraLite® Plus 488 LRRC50 antibody (CL488-30156) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using CL488-30156

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using CoraLite® Plus 488 LRRC50 antibody (CL488-30156) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LRRC50 Polyclonal Antibody for IF-P

Cat No. CL488-30156

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IF-P

Synonyms

DKFZp434A119, DNAAF1, FLJ25330, LRRC50

---

Tested Applications

• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-30156 targets LRRC50 in IF-P applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32822

  Product name: Recombinant human LRRC50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 522-680 aa of BC024009

  Sequence: FVTELDGTRTEDLETIRLETKETCCIDDLPDLEDDDETGKSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFKKEAKRDSEIRKQDTKSPRPLIQELSDEDPSGQPLMPPTCQRDAAPLTSTGDRDS

• Full Name: leucine rich repeat containing 50
• Calculated Molecular Weight: 725 aa, 80 kDa
• GenBank Accession Number: BC024009
• Gene Symbol: LRRC50
• Gene ID (NCBI): 123872
• RRID: AB_3672843
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEP3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

LRRC50 is a cilium-specific protein required for the stability of the ciliary architecture, it plays a role in cytoplasmic preassembly of dynein arms.