LRRC57 Polyclonal antibody

• 

  WB analysis using 32285-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32285-1-AP (LRRC57 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

LRRC57 Polyclonal Antibody for WB, ELISA

Cat No. 32285-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Leucine-rich repeat-containing protein 57, Leucine Rich Repeat Containing 57

---

Tested Applications

• Positive WB detected in: HT-29 cells, HepG2 cells, JurKat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32285-1-AP targets LRRC57 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36790

  Product name: Recombinant human LRRC57 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC058935

  Sequence: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA

• Full Name: leucine rich repeat containing 57
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC058935
• Gene Symbol: LRRC57
• Gene ID (NCBI): 255252
• RRID: AB_3670231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N9N7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Increased expression of the LRRC57 (Leucine-rich repeat containing 57) gene has been associated with bipolar disorder. The other functions of LRRC57 are not fully understood, but it plays a role in a number of cellular processes, including cell proliferation, signaling, and metabolism.