LRRFIP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRRFIP2 Polyclonal antibody, PBS Only (27614-1-PBS)

• 

  WB analysis using 27614-1-AP (same clone as 27614-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27614-1-AP (LRRFIP2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27614-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27614-1-AP (same clone as 27614-1-PBS)

  J774A.1 cells were subjected to SDS PAGE followed by western blot with 27614-1-AP (LRRFIP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27614-1-PBS in a different storage buffer formulation.

LRRFIP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27614-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

HUFI 2, LRR FLII interacting protein 2

---

Product Information

27614-1-PBS targets LRRFIP2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26355

  Product name: Recombinant human LRRFIP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-300 aa of BC053668

  Sequence: IEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIE

• Full Name: leucine rich repeat (in FLII) interacting protein 2
• Calculated Molecular Weight: 400 aa, 45 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC053668
• Gene Symbol: LRRFIP2
• Gene ID (NCBI): 9209
• RRID: AB_3742243
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y608
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LRRFIP2 (Leucine-rich repeat flightless-interacting protein 2) is a cytoplasmic protein that regulates innate immune signaling by modulating nucleic acid-sensing pathways. It interacts with flightless-I homolog and plays roles in inflammation and antiviral responses .