LRRIQ1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRRIQ1 Polyclonal antibody, PBS Only (26063-1-PBS)

• 

  WB analysis of mouse brain using 26063-1-AP (same clone as 26063-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26063-1-AP (LRRIQ1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26063-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 26063-1-AP (same clone as 26063-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26063-1-AP (LRRIQ1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26063-1-PBS in a different storage buffer formulation.

LRRIQ1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26063-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26063-1-PBS targets LRRIQ1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22057

  Product name: Recombinant human LRRIQ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-224 aa of BC005399

  Sequence: MDDDDAKLKAEIEAELDKLSISSLEKEDIESDAKSETQSDDSDTDSVELPESVLHCINIIKNRSKAVEELILQDLEDILSCSYGAVSNNHMHLRTGLSTEYEESSEQLIKILSEIEKEEFMRSKTDCATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKRHCWMKQFKVEKKKLENIQK

• Full Name: leucine-rich repeats and IQ motif containing 1
• Calculated Molecular Weight: 1722 aa, 199 kDa
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: BC005399
• Gene Symbol: LRRIQ1
• Gene ID (NCBI): 84125
• RRID: AB_3085838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JM4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LRRIQ1 (leucine-rich repeats and IQ motif containing 1), also named as KIAA1801, is known to be hignly expressed in brain and testis tissue. The LRRIQ1 gene is conserved in chimpanzee, Rhesus monkey, dog, cow, mouse, rat, chicken, and zebrafish.