LSM2 Polyclonal antibody

LSM2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10963-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

C6orf28, G7B, Protein G7b, snRNP, snRNP core Sm-like protein Sm-x5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, HEK-293 cells, K-562 cells, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

10963-1-AP targets LSM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1412

Product name: Recombinant human LSM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-95 aa of BC009192

Sequence: MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Predict reactive species
Full Name LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Calculated Molecular Weight 11 kDa
Observed Molecular Weight11 kDa
GenBank Accession NumberBC009192
Gene Symbol LSM2
Gene ID (NCBI) 57819
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y333
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing (PMID:15075370). Lsm2-Lsm8 (Lsm stands for Like Sm), binds and stabilizes the 3′ end of the spliceosomal U6 snRNA Lsm proteins facilitate the annealing of U6 snRNA with U4 snRNA in vitro and interact with the U4/U6 annealing factor Prp24, suggesting that Lsm proteins function in U4/U6 snRNP formation in vivo (PMID:15485930, 17251193).

Protocols

Product Specific Protocols
IHC protocol for LSM2 antibody 10963-1-APDownload protocol
WB protocol for LSM2 antibody 10963-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Proteomics

Low-molecular-mass secretome profiling identifies C-C motif chemokine 5 as a potential plasma biomarker and therapeutic target for nasopharyngeal carcinoma.

Authors - Lin Shih-Jie SJ
Loading...
||
New chat Able
正在加载,请稍候...