LSM5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LSM5 Polyclonal antibody, PBS Only (10700-1-PBS)

• 

  WB analysis of HeLa using 10700-1-AP (same clone as 10700-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10700-1-AP (LSM5 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10700-1-AP (same clone as 10700-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10700-1-AP (LSM5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 10700-1-AP (same clone as 10700-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10700-1-AP (LSM5 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse ovary using 10700-1-AP (same clone as 10700-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 10700-1-AP (LSM5 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10700-1-AP (same clone as 10700-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10700-1-AP (LSM5 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 10700-1-AP (same clone as 10700-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 10700-1-AP (LSM5 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10700-1-AP (same clone as 10700-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10700-1-AP (LSM5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10700-1-AP (same clone as 10700-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10700-1-AP (LSM5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10700-1-AP (same clone as 10700-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10700-1-AP (LSM5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10700-1-AP (same clone as 10700-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 10700-1-AP (LSM5 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10700-1-PBS in a different storage buffer formulation.

LSM5 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10700-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

10700-1-PBS targets LSM5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1145

  Product name: Recombinant human LSM5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC005938

  Sequence: MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

• Full Name: LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC005938
• Gene Symbol: LSM5
• Gene ID (NCBI): 23658
• RRID: AB_2138475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4Y9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.