LSM6 Polyclonal antibody

• 

  IHC staining of human stomach using 12138-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12138-1-AP (LSM6 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 12138-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12138-1-AP (LSM6 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 12138-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12138-1-AP (LSM6 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 12138-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12138-1-AP (LSM6 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LSM6 Polyclonal Antibody for IHC, ELISA

Cat No. 12138-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

LSM6, YDR378C

---

Tested Applications

• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12138-1-AP targets LSM6 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2784

  Product name: Recombinant human LSM6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC016026

  Sequence: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

• Full Name: LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Calculated Molecular Weight: 80 aa, 9 kDa
• GenBank Accession Number: BC016026
• Gene Symbol: LSM6
• Gene ID (NCBI): 11157
• RRID: AB_2616314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62312
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LSM6 plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex) (PMID: 28781166). LSM6 is a component of LSm protein complexes, and LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA (PMID: 10523320).