LSP1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• LSP1 Recombinant monoclonal antibody, PBS Only (87378-1-PBS)

• 

  WB analysis using 87378-1-RR (same clone as 87378-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87378-1-RR (LSP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87378-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 87378-1-RR (same clone as 87378-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 87378-1-RR (LSP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87378-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Daudi using 87378-1-RR (same clone as 87378-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Daudi cells using LSP1 antibody (87378-1-RR, Clone: 252179A7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87378-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87378-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87378-1-RR against Human LSP1 were performed. The affinity constant is 3.05 nM.

LSP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 87378-1-PBS

Clone No.252179A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

47 kDa actin-binding protein, Lymphocyte-specific antigen WP34, Lymphocyte-specific protein 1, pp52, WP34

---

Product Information

87378-1-PBS targets LSP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5464

  Product name: Recombinant human LSP1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-339 aa of NM_002339.2

  Sequence: MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP

• Full Name: lymphocyte-specific protein 1
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_002339.2
• Gene Symbol: LSP1
• Gene ID (NCBI): 4046
• RRID: AB_3745497
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P33241-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Lymphocyte-specific protein 1(LSP1), also known as leukocyte-specific protein 1, is an F-actin binding and cytoskeleton associated protein. The protein is expressed in lymphocytes, neutrophils, and macrophages. LSP1 is a substrate for mitogen-activated protein kinase (MAPK)-activated protein kinase 2 and protein kinase C. The implication of LSP1 in diverse biological processes, such as inflammation and malignancy, suggests the major regulatory role of LSP1 in signal transduction(PMID: 38254711).