Use Able AI chat for product recommendations

LYPD3 Recombinant monoclonal antibody, PBS Only (Capture)

LYPD3 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83345-1-PBS
Clone No.240347C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

240347C5, C4.4A, LY6/PLAUR domain containing 3, MIG C4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83345-1-PBS targets LYPD3 as part of a matched antibody pair:

MP00387-2: 83345-1-PBS capture and 83345-2-PBS detection (validated in Cytometric bead array)

MP00387-3: 83345-1-PBS capture and 83345-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34961

Product name: Recombinant human LYPD3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 31-326 aa of NM_014400

Sequence: LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC

Predict reactive species
Full Name LY6/PLAUR domain containing 3
Calculated Molecular Weight36 kDa
GenBank Accession NumberNM_014400
Gene Symbol LYPD3
Gene ID (NCBI) 27076
RRIDAB_3671004
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95274
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LYPD3 (Ly6/PLAUR domain-containing protein 3), also known as C4.4A , is a membrane protein anchored to the cell surface via a glycosylphosphatidylinositol (GPI) moiety (PMID: 25302166; 15012588). It is a tumorigenic and high-glycosylated protein that has been proven to be linked with the carcinogenic effects in different solid tumors, such as lung cancer and breast cancer (PMID: 32040344; 29371917; 31644911). It has been shown that the elevated expression of LYPD3 is associated with lung adenocarcinoma carcinogenesis and poor prognosis (PMID: 25302166; 32040344).

Loading...
||
New chat

Able

正在加载,请稍候...