LYPD6B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LYPD6B Polyclonal antibody (25508-1-AP)

• 

  IHC staining of mouse lung using 25508-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 25508-1-AP (LYPD6B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 25508-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 25508-1-AP (LYPD6B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LYPD6B Polyclonal Antibody for IHC, ELISA

Cat No. 25508-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

CT116, Ly6/PLAUR domain-containing protein 6B, LYPD7

---

Tested Applications

• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25508-1-AP targets LYPD6B in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22008

  Product name: Recombinant human LYPD6B protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-83 aa of BC040176

  Sequence: MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNS

• Full Name: LY6/PLAUR domain containing 6B
• Calculated Molecular Weight: 183 aa, 20 kDa
• GenBank Accession Number: BC040176
• Gene Symbol: LYPD6B
• Gene ID (NCBI): 130576
• RRID: AB_3742150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NI32
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LYPD6B (containing the Ly6/PLAUR domain protein 6B), also known as LYPD7, is a member of the Ly6/uPAR superfamily of proteins. These proteins typically exhibit membrane-anchoring properties and participate in critical cellular signaling and adhesion processes. It is predominantly expressed in the central nervous system. LYPD6B functions as a key regulatory subunit that interacts with and modulates nicotinic acetylcholine receptors (nAChRs), specifically influencing their maturation, stability, and functional properties at synapses. This interaction is crucial for normal cholinergic signaling, which underpins cognitive functions such as learning and memory. Dysfunction of the LYPD6B is associated with multiple neurological disorders. (PMID: 23186997, PMID: 34631692, PMID: 39433742)