LYRM2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LYRM2 Polyclonal antibody (31674-1-AP)

• 

  IP experiment of COLO 320 using 31674-1-AP

  IP result of anti-LYRM2 (IP:31674-1-AP, 4ug; Detection:31674-1-AP 1:500) with COLO 320 cells lysate 1920 ug.

• 

  IP experiment of HT-29 using 31674-1-AP

  IP result of anti-LYRM2 (IP:31674-1-AP, 4ug; Detection:31674-1-AP 1:500) with HT-29 cells lysate 1760 ug.

LYRM2 Polyclonal Antibody for IP, ELISA

Cat No. 31674-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, ELISA

Synonyms

LYR motif containing 2

---

Tested Applications

• Positive IP detected in: HT-29 cells, COLO 320 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31674-1-AP targets LYRM2 in IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36366

  Product name: Recombinant human LYRM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-88 aa of BC009782

  Sequence: QQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMITQGNMQLKELEKTLALAKS

• Full Name: LYR motif containing 2
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC009782
• Gene Symbol: LYRM2
• Gene ID (NCBI): 57226
• RRID: AB_3742461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NU23
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LYR motif containing 2 (LYRM2) is an evolutionarily conserved gene which belongs to LYR (leucine-tyrosine-arginine) motif proteins (LYRMs) family. LYRM2 is the one of the top ten most significantly upregulated differentially expressed genes in trabecular osteocytes between osteoporosis and normal controls (PMID: 34252604), which is up-regulated in colorectal cancer and promotes tumor growth both in vivo and in vitro. LYRM2 locates in the mitochondrial inner membrane and matrix (PMID: 31004700).