LYVE1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• LYVE1 Recombinant monoclonal antibody, PBS Only (84526-4-PBS)

LYVE1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84526-4-PBS

Clone No.253109A7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Cell surface retention sequence-binding protein 1, CRSBP 1, CRSBP1, CRSBP-1, Extracellular link domain-containing protein 1

• 

  WB analysis using 84526-4-RR (same clone as 84526-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84526-4-RR (LYVE1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84526-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

84526-4-PBS targets LYVE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28131

  Product name: Recombinant human LYVE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 192-322 aa of BC026231

  Sequence: SIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV

• Full Name: lymphatic vessel endothelial hyaluronan receptor 1
• Calculated Molecular Weight: 322 aa, 35 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC026231
• Gene Symbol: LYVE1
• Gene ID (NCBI): 10894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5Y7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LYVE1 is a 322-amino acid type-I integral membrane glycoprotein primarily expressed on lymphatic endothelial cells. LYVE1 is a CD44 homologue. It acts as a receptor and binds to both soluble and immobilized hyaluronan. LYVE1 may function in lymphatic hyaluronan transport and in tumor metastasis.