LZIC Polyclonal antibody

• 

  WB analysis of BxPC-3 using 14543-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 14543-1-AP (LZIC antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of BxPC-3 using 14543-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 14543-1-AP (LZIC antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14543-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14543-1-AP (LZIC antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 14543-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14543-1-AP (LZIC antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

LZIC Polyclonal Antibody for WB, ELISA

Cat No. 14543-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

LZIC, Protein LZIC

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HepG2 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14543-1-AP targets LZIC in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6047

  Product name: Recombinant human LZIC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC063443

  Sequence: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK

• Full Name: leucine zipper and CTNNBIP1 domain containing
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21-24 kDa
• GenBank Accession Number: BC063443
• Gene Symbol: LZIC
• Gene ID (NCBI): 84328
• RRID: AB_2138923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WZA0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LZIC is closely related to ICAT, a physiological inhibitor of the Wnt pathway that interacts physically and functionally with β-catenin to prevent the transcription of Wnt target genes. LZIC's ICAT-homologous region is highly similar to ICAT with particular conservation of residues that are used by ICAT for β-catenin-binding. LZIC does not interact with β-catenin in vitro or in vivo. LZIC is a protein conserved in vertebrates, is required for neuronal survival.