LZIC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LZIC Polyclonal antibody (14543-1-AP)

LZIC Polyclonal Antibody for WB, ELISA

Cat No. 14543-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Leucine zipper and CTNNBIP1 domain-containing protein, Leucine zipper and ICAT homologous domain-containing protein, Protein LZIC

• 

  WB analysis using 14543-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14543-1-AP (LZIC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LZIC in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HEK-293 cells, HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14543-1-AP targets LZIC in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6047

  Product name: Recombinant human LZIC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC063443

  Sequence: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK

• Full Name: leucine zipper and CTNNBIP1 domain containing
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21-24 kDa
• GenBank Accession Number: BC063443
• Gene Symbol: LZIC
• Gene ID (NCBI): 84328
• RRID: AB_2138923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WZA0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LZIC is closely related to ICAT, a physiological inhibitor of the Wnt pathway that interacts physically and functionally with β-catenin to prevent the transcription of Wnt target genes. LZIC's ICAT-homologous region is highly similar to ICAT with particular conservation of residues that are used by ICAT for β-catenin-binding. LZIC does not interact with β-catenin in vitro or in vivo. LZIC is a protein conserved in vertebrates, is required for neuronal survival.

Publications

What published studies show

The LZIC Polyclonal antibody (Cat# 14543-1-AP) has 1 citation to date. It was cited in Cell Death Discovery (IF 10.4, 2026) for a study comparing serum and tissue proteomic profiles in non-small cell lung cancer patients with or without brain metastasis. The antibody was applied via IHC in human samples, placing the research in the fields of oncology, proteomics, and metastasis biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Death Discov; A comparative analysis of serum and tissue proteomic profiles in non-small cell lung cancer patients with or without brain metastasis.; Authors - Yongtao Zheng