Lipocalin-2/NGAL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82841-1-RR (same clone as 82841-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82841-1-RR (Lipocalin-2/NGAL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82841-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 82841-1-RR (same clone as 82841-1-PBS)

  WB result of NGAL antibody (82841-1-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-NGAL transfected HT-29 cells. This data was developed using the same antibody clone with 82841-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 82841-1-RR (same clone as 82841-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 82841-1-RR (NGAL antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82841-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82841-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82841-1-RR against Human NGAL were performed. The affinity constant is 0.776 nM.

• Featured Product
• KD/KO Validated

Lipocalin-2/NGAL Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 82841-1-PBS

Clone No.2G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

LCN2, lipocalin 2, NGAL, 24p3, 25 kDa alpha-2-microglobulin-related subunit of MMP-9

---

Product Information

82841-1-PBS targets Lipocalin-2/NGAL in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0268

  Product name: Recombinant Human NGAL/Lipocalin-2 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*HIS

  Domain: 21-198 aa of NP_005555.2

  Sequence: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

• Full Name: lipocalin 2
• Calculated Molecular Weight: 23kd
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NP_005555.2
• Gene Symbol: NGAL/LCN2
• Gene ID (NCBI): 3934
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P80188
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Lipocalin-2 (LCN-2) is a adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). Lipocalin-2 is a circulatory protein responsible for the transportation of small and hydrophobic molecules to target organs. Lipocalin-2 is used as a biomarker for acute and chronic renal injury. It is present in a large variety of cells including neutrophil, hepatocytes, lung, bone marrow, adipose tissue, macrophages, thymus, non-neoplastic breast duct, prostate, and renal cells. Different functions have been associated with Lipocalin-2, including antibacterial, anti-inflammatory, and protection against cell and tissue stress (PMID:34463264).