Rat Lipocalin-2/NGAL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83853-2-RR (same clone as 83853-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83853-2-RR (Lipocalin-2/NGAL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83853-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 83853-2-RR (same clone as 83853-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 83853-2-RR (Lipocalin-2/NGAL antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83853-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 83853-2-RR (same clone as 83853-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 83853-2-RR (Lipocalin-2/NGAL antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83853-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83853-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83853-2-RR against Rat Lipocalin-2/Ngal were performed. The affinity constant is 0.195 nM.

Lipocalin-2/NGAL Uni-rAb^® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 83853-2-PBS

Clone No.240792C12

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

Lcn2, Lipocalin2/NGAL, 240792C12, Alpha-2-microglobulin-related protein, Alpha-2U globulin-related protein

---

Product Information

83853-2-PBS targets Lipocalin-2/NGAL in WB, IHC, Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1022

  Product name: Recombinant Rat Lipocalin-2/NGAL protein (His Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 21-198 aa of

  Sequence: QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN

• Full Name: lipocalin 2
• Calculated Molecular Weight: 22kDa
• Observed Molecular Weight: 22-25 kDa
• Gene Symbol: Lipocalin-2/NGAL
• Gene ID (NCBI): 170496
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30152
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Neutrophil gelatinase-associated lipocalin (NGAL, also known as lipocalin-2, siderocalin, or LCN2) is a small molecule of almost 25 kDa that belongs to the well-defined superfamily of proteins called lipocalins. NGAL was initially found in activated neutrophils, under its role as an innate antibacterial factor. However, it was subsequently shown that many other types of cells, including those in the kidney tubule, may produce NGAL in response to various injuries. NGAL may become one of the most promising next-generation biomarkers in clinical nephrology and beyond. This antibody recognizes rat Lipocalin-2/Ngal.