Rat Lumican Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of Recombinant protein using 85629-1-RR (same clone as 85629-1-PBS)

  Recombinant protein were subjected to SDS PAGE followed by western blot with 85629-1-RR (Lumican antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85629-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85629-1-RR (same clone as 85629-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85629-1-RR (Lumican antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85629-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85629-1-RR (same clone as 85629-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85629-1-RR (Lumican antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85629-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 85629-1-RR (same clone as 85629-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 85629-1-RR (Lumican antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85629-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 85629-1-RR (same clone as 85629-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 85629-1-RR (Lumican antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85629-1-PBS in a different storage buffer formulation.

Lumican Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85629-1-PBS

Clone No.242298G6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Keratan sulfate proteoglycan lumican, KSPG lumican, Lcn, Ldc, Lum

---

Product Information

85629-1-PBS targets Lumican in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3410

  Product name: Recombinant Rat Lumican protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 19-338 aa of NM_031050.1

  Sequence: QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN

• Full Name: lumican
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 50-90 kDa
• GenBank Accession Number: NM_031050.1
• Gene Symbol: Lum
• Gene ID (NCBI): 81682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51886
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

umican (LUM), a member of the small leucine-rich proteoglycan (SLRP) family, is one of the major extracellular components in interstitial collagenous matrices of the corneal stroma, aorta, skin, skeletal muscle, lung, kidney, bone, cartilage, and intervertebral discs. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins and have important effects on cell behavior. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and may exist as a glycoprotein in the connective tissues of other organs. Posttranslational modifications lumican goes through can increase its apparent molecular weight to 50-90 kDa. Studies show that lumican participates in the maintenance of tissue homeostasis and modulates cellular functions including cell proliferation, migration, and differentiation. (PMID: 18949819; 22252641; 9761754; 22365843)