Ly-6G Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Ly-6G Recombinant monoclonal antibody (84820-5-RR)

Ly-6G Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84820-5-RR Copied!

Clone No. 260832C1

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

Ly6g, Ly 6G, Ly-6G.1

• 

  WB analysis using 84820-5-RR

  Mouse bone marrow tissue were subjected to SDS PAGE followed by western blot with 84820-5-RR (Ly-6G antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. Ly-6G deficient cell lines C2C12 and NIH/3T3 were used as negative controls.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 84820-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84820-5-RR (Ly-6G antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 84820-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84820-5-RR (Ly-6G antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Ly-6G in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse bone marrow
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84820-5-RR targets Ly-6G in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2609

  Product name: Recombinant Mouse Ly-6G protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-114 aa of NM_001310438.1

  Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS

• Full Name: lymphocyte antigen 6 complex, locus G
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 20-30 kDa
• GenBank Accession Number: NM_001310438.1
• Gene Symbol: Ly-6G
• Gene ID (NCBI): 546644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35461
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).