Tested Applications
Positive FC detected in | mouse bone marrow cells |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) | FC : 0.25 ug per 10^6 cells in 100 μl suspension |
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
98284-1-RR targets Ly-6G in FC applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2609 Product name: Recombinant Mouse Ly6g protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 21-114 aa of NM_001310438.1 Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS Predict reactive species |
Full Name | lymphocyte antigen 6 complex, locus G |
Calculated Molecular Weight | 14 kDa |
GenBank Accession Number | NM_001310438.1 |
Gene Symbol | Ly-6G |
Gene ID (NCBI) | 546644 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | P35461 |
Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).
Protocols
Product Specific Protocols | |
---|---|
FC protocol for Ly-6G antibody 98284-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |