Biotin Anti-Mouse Ly-6G Rabbit Recombinant Antibody

Ly-6G Uni-rAb® Recombinant Antibody for FC
Cat No. Biotin-98284
Clone No.242141B11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Ly6g, 242141B11, Ly 6G, Ly-6G.1

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse bone marrow cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-98284 targets Ly-6G in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2609

Product name: Recombinant Mouse Ly6g protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 21-114 aa of NM_001310438.1

Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS

Predict reactive species
Full Name lymphocyte antigen 6 complex, locus G
Calculated Molecular Weight14 kDa
GenBank Accession NumberNM_001310438.1
Gene Symbol Ly-6G
Gene ID (NCBI) 546644
Conjugate Biotin
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35461
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).

Protocols

Product Specific Protocols
FC protocol for Biotin Ly-6G antibody Biotin-98284Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...