Biotin Anti-Mouse Ly-6G Rabbit Recombinant Antibody

• 

  FC experiment of mouse bone marrow cells using Biotin-98284

  1x10^6 mouse bone marrow cells were surface stained with CoraLite® Plus 647 Anti-Mouse CD11b, and 0.25 ug Biotin Anti-Mouse Ly-6G Rabbit RecAb (Biotin-98284, Clone: 242141B11) or unstained. Cells were not fixed.

• 

  FC experiment of mouse bone marrow cells using Biotin-98284

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Biotin Anti-Mouse Ly-6G Rabbit RecAb (Biotin-98284, Clone: 242141B11) (red) or unstained (blue). Cells were not fixed.

Ly-6G Uni-rAb^® Recombinant Antibody for FC

Cat No. Biotin-98284

Clone No.242141B11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Ly6g, 242141B11, Ly 6G, Ly-6G.1

---

Tested Applications

• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-98284 targets Ly-6G in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2609

  Product name: Recombinant Mouse Ly6g protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-114 aa of NM_001310438.1

  Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS

• Full Name: lymphocyte antigen 6 complex, locus G
• Calculated Molecular Weight: 14 kDa
• GenBank Accession Number: NM_001310438.1
• Gene Symbol: Ly-6G
• Gene ID (NCBI): 546644
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35461
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).