FITC Plus Anti-Mouse Ly-6G Rabbit Recombinant Antibody

Ly-6G Uni-rAb® Recombinant Antibody for FC
Cat No. FITC-98284
Clone No.242141B11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Ly6g, 242141B11, Ly 6G, Ly-6G.1

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse bone marrow cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98284 targets Ly-6G in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2609

Product name: Recombinant Mouse Ly6g protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 21-114 aa of NM_001310438.1

Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS

Predict reactive species
Full Name lymphocyte antigen 6 complex, locus G
Calculated Molecular Weight14 kDa
GenBank Accession NumberNM_001310438.1
Gene Symbol Ly-6G
Gene ID (NCBI) 546644
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35461
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).

Protocols

Product Specific Protocols
FC protocol for FITC Plus Ly-6G antibody FITC-98284Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...