Anti-Mouse Ly-6G Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse bone marrow cells using 98284-1-RR (same clone as 98284-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse Ly-6G Rabbit RecAb (98284-1-RR, Clone: 242141B11) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD11b (M1/70) (CL647-65055, Clone: M1/70). Cells were not fixed. This data was developed using the same antibody clone with 98284-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse bone marrow cells using 98284-1-RR (same clone as 98284-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse Ly-6G Rabbit RecAb (98284-1-RR, Clone:242141B11) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98284-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98284-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98284-1-RR against Mouse Ly-6G were performed. The affinity constant is 0.381 nM.

Ly-6G Uni-rAb^® Recombinant Antibody for FC

Cat No. 98284-1-PBS

Clone No.242141B11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Ly6g, 242141B11, Ly 6G, Ly-6G.1

---

Product Information

98284-1-PBS targets Ly-6G in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2609

  Product name: Recombinant Mouse Ly6g protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-114 aa of NM_001310438.1

  Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS

• Full Name: lymphocyte antigen 6 complex, locus G
• Calculated Molecular Weight: 14 kDa
• GenBank Accession Number: NM_001310438.1
• Gene Symbol: Ly-6G
• Gene ID (NCBI): 546644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P35461
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901).