MACC1 Polyclonal antibody

MACC1 Polyclonal Antibody for IHC, ELISA
Cat No. 21970-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

7A5, MACC1, SH3BP4L

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman liver cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

21970-1-AP targets MACC1 in IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16884

Product name: Recombinant human MACC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 502-852 aa of BC137090

Sequence: ITTPDPTPNLKRLSNLPGYLQKKEEIKSAPLSPKILVKYPTFQDKTLNFSNYGVTLKAVLRQSKIDYFLEYFKGDTIALLGEGKVKAIGQSKVKEWYVGVLRGKIGLVHCKNVKVISKEQVMFMSDSVFTTRNLLEQIVLPLKKLTYIYSVVLTLVSEKVYDWKVLADVLGYSHLSLEDFDQIQADKESEKVSYVIKKLKEDCHTERNTRKFLYELIVALLKMDCQELVARLIQEAAVLTSAVKLGKGWRELAEKLVRLTKQQMEAYEIPHRGNTGDVAVEMMWKPAYDFLYTWSAHYGNNYRDVLQDLQSALDRMKNPVTKHWRELTGVLILVNSLEVLRVTAFSTSEEV

Predict reactive species
Full Name metastasis associated in colon cancer 1
Calculated Molecular Weight 852 aa, 97 kDa
GenBank Accession NumberBC137090
Gene Symbol MACC1
Gene ID (NCBI) 346389
RRIDAB_2878957
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6ZN28
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MACC1, Metalloantigenolytic Cleavage Cartilage Proteinase 1, belongs to the ADAM (a disintegrin and metalloprotease) family. MACC1 was first identified in colon cancer. It is a key prognostic biomarker and is involved in recurrence, metastasis, and survival in solid cancers (PMID: 23815185). MACC1 expression is primarily observed in cartilage, but it's also present in other tissues like bone, synovium, and the developing nervous system (PMID: 36979146).

Protocols

Product Specific Protocols
IHC protocol for MACC1 antibody 21970-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Mol Carcinog

The role of metastasis-associated in colon cancer 1 (MACC1) in endometrial carcinoma tumorigenesis and progression.

Authors - Shuo Chen
humanIHC

Int J Med Sci

Bioinformatics Analysis Reveals a Novel Prognostic Model for Esophageal Squamous Cell Carcinoma

Authors - Huan Yang
Loading...
||
New chat Able
正在加载,请稍候...