MADD Polyclonal antibody

• 

  WB analysis using 29663-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29663-1-AP (MADD antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 29663-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 29663-1-AP (MADD antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MADD Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29663-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

MAP kinase-activating death domain protein, KIAA0358, IG20, FLJ36300, FLJ35600

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29663-1-AP targets MADD in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31292

  Product name: Recombinant human MADD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1395-1544 aa of BC040484

  Sequence: WRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS

• Full Name: MAP-kinase activating death domain
• Calculated Molecular Weight: 1544 aa, 171 kDa
• Observed Molecular Weight: 200-250 kDa
• GenBank Accession Number: BC040484
• Gene Symbol: MADD
• Gene ID (NCBI): 8567
• RRID: AB_3086151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXG6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MADD, MAP kinase-activating death domain protein, belongs to the DENN family, which regulates the Rab family is small GTPases (PMID: 20937701, PMID: 18559336). MADD plays a role in synaptic vesicle formation and in vesicle trafficking at the neuromuscular junction. MADD is also involved in TNFA-mediated activation of the MAPK pathway, including ERK1/2 (PMID: 32761064). KIF1Bβ- and KIF1A-mediated axonal transport of presynaptic regulator Rab3 occurs in a GTP-dependent manner through MADD (PMID: 18849981).