MAEA Recombinant monoclonal antibody, PBS Only

MAEA Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83267-2-PBS
Clone No.240097C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

240097C9, Cell proliferation-inducing gene 5 protein, E3 ubiquitin-protein transferase MAEA, EC:2.3.2.27, EMLP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83267-2-PBS targets MAEA in WB, FC (Intra), Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27150

Product name: Recombinant human MAEA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 26-239 aa of BC001225

Sequence: YETLNKRFRAAQKNIDRETSHVTMVVAELEKTLSGCPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLAWCHDNKSRLRKMKSCLEFSLRIQEFIELIRQNKRLDAVRHARKHFSQAEGSQLDEVRQA

Predict reactive species
Full Name macrophage erythroblast attacher
Calculated Molecular Weight 45 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC001225
Gene Symbol MAEA
Gene ID (NCBI) 10296
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7L5Y9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MAEA(macrophage erythroblast attacher) is a core component of the CTLH E3 ubiquitin-protein ligase complex. MAEA is required for normal cell proliferation and plays a role in erythroblast enucleation during erythrocyte maturation and in the development of mature macrophages. N-terminus MAEA and full-length MAEA are mostly expressed in nuclear and can be detected at low level in the cytoplasm of some cells, while C-terminus MAEA can be detected in the cytoplasm and nucleoli within the nucleus. MAEA mediates the attachment of erythroid cell to mature macrophages which can inhibit erythroid cell apoptosis. The expression of MAEA may be associated with the type 2 diabetes mellitus.(PubMed: 28955747, 24143168, 29911972, 29911972, 30674470, 9763581).

Loading...
||
New chat Able
正在加载,请稍候...