MAEL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAEL Polyclonal antibody (26666-1-AP)

• Featured Product
• KD/KO Validated

MAEL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26666-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, RIP, ELISA

Synonyms

MAEL, maelstrom homolog (Drosophila), Protein maelstrom homolog, RP11 102C16.1

• 

  WB analysis of rat testis using 26666-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 26666-1-AP (MAEL Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 26666-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 26666-1-AP (MAEL Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 26666-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26666-1-AP (MAEL Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 26666-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26666-1-AP (MAEL Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 26666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26666-1-AP (MAEL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MAEL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat testis tissue, mouse testis tissue
• Positive IHC detected in: human testis tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26666-1-AP targets MAEL in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24524

  Product name: Recombinant human MAEL protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 282-434 aa of BC028595

  Sequence: RCKWHEENDILFCALAVCKKIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVGSSGFSHFNSSNEEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSPYMSQKDGYKSFSSLS

• Full Name: maelstrom homolog (Drosophila)
• Calculated Molecular Weight: 434 aa, 49 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC028595
• Gene Symbol: MAEL
• Gene ID (NCBI): 84944
• RRID: AB_2880595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JY0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MAEL Polyclonal antibody (Cat# 26666-1-AP) has 2 total citations. These publications appear in Journal of Cellular and Molecular Medicine and Andrology. The research fields associated with these citations are reproductive biology and male infertility, specifically investigating TDRD6 loss-of-function variants causing oligo-astheno-teratozoospermia in humans and mice, and MAEL mitochondrial expression in human spermatozoa linked to asthenozoospermia. Applications cited include WB, IHC, IF, and RIP.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Cell Mol Med; Loss-of-function variant in TDRD6 cause male infertility with severe oligo-astheno-teratozoospermia in human and mice; Authors - Xinying Bi
human	WB,IHC,IF,RIP	Andrology; The MAEL expression in mitochondria of human spermatozoa and the association with asthenozoospermia; Authors - Yu-Sheng Cheng ; KD Validated