MAGEA11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MAGEA11 Polyclonal antibody, PBS Only (15474-1-PBS)

• 

  WB analysis of A375 using 15474-1-AP (same clone as 15474-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 15474-1-AP (MAGEA11 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15474-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 15474-1-AP (same clone as 15474-1-PBS)

  Immunofluorescent analysis of A375 cells using 15474-1-AP (MAGEA11 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15474-1-PBS in a different storage buffer formulation.

MAGEA11 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 15474-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

15474-1-PBS targets MAGEA11 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7778

  Product name: Recombinant human MAGEA11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 79-429 aa of BC004479

  Sequence: RTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV

• Full Name: melanoma antigen family A, 11
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa, 44 kDa
• GenBank Accession Number: BC004479
• Gene Symbol: MAGEA11
• Gene ID (NCBI): 4110
• RRID: AB_2137973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43364
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.