MAGEA8 Polyclonal antibody

MAGEA8 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 15045-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Melanoma-associated antigen 8, MAGE-8 antigen, MAGE8, CT1.8, Cancer/testis antigen 1.8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells
Positive IHC detected inhuman testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2400
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15045-1-AP targets MAGEA8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6984

Product name: Recombinant human MAGEA8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-318 aa of BC002455

Sequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV

Predict reactive species
Full Name melanoma antigen family A, 8
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC002455
Gene Symbol MAGEA8
Gene ID (NCBI) 4107
RRIDAB_2138289
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43361
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for MAGEA8 antibody 15045-1-APDownload protocol
IHC protocol for MAGEA8 antibody 15045-1-APDownload protocol
WB protocol for MAGEA8 antibody 15045-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...