MAGEC3 Polyclonal antibody

• 

  WB analysis of A375 using 21491-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 21491-1-AP (MAGEC3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 21491-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 21491-1-AP (MAGEC3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 21491-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 21491-1-AP (MAGEC3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 21491-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 21491-1-AP (MAGEC3 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of A375 using 21491-1-AP

  Immunofluorescent analysis of A375 cells using 21491-1-AP (MAGEC3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

MAGEC3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21491-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Melanoma-associated antigen C3, MAGE-C3 antigen, Hepatocellular carcinoma-associated antigen 2, HCA2, CT7.2

---

Tested Applications

• Positive WB detected in: A375 cells, mouse thymus tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IP: See 1 publications below

Product Information

21491-1-AP targets MAGEC3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15819

  Product name: Recombinant human MAGEC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-130 aa of BC103893

  Sequence: MPLFPNLPRLSFEEDFQNPSVTEDLVDAQDSIDEEEEDASSTSSSSFHFLFPSSSSLSSSSPLSSPLPSTLILGVPEDEDMPAAGMPPLPQSPPEIPPQGPPKISPQGPPQSPPQSPLDSCSSPLLWTRL

• Full Name: melanoma antigen family C, 3
• Calculated Molecular Weight: 643 aa, 72 kDa
• Observed Molecular Weight: 70-72 kDa
• GenBank Accession Number: BC103893
• Gene Symbol: MAGEC3
• Gene ID (NCBI): 139081
• RRID: AB_10734430
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TD91
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IP	Cancer Commun (Lond); MAGE-C3 promotes cancer metastasis by inducing epithelial-mesenchymal transition and immunosuppression in esophageal squamous cell carcinoma.; Authors - Qingnan Wu
human	WB	BMC Cancer; Post-transcriptional regulation of cancer/testis antigen MAGEC2 expression by TRIM28 in tumor cells.; Authors - Xiao Song