MAGI3 Polyclonal antibody

• 

  WB analysis using 22615-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22615-1-AP (MAGI3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 22615-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 22615-1-AP (MAGI3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MAGI3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22615-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA1634, MAGI-3, Membrane-associated guanylate kinase inverted 3, Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22615-1-AP targets MAGI3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18394

  Product name: Recombinant human MAGI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 496-777 aa of BC130409

  Sequence: LPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQNGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSPTKTAKMKTDKKENAGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCID

• Full Name: membrane associated guanylate kinase, WW and PDZ domain containing 3
• Calculated Molecular Weight: 1481 aa, 163 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC130409
• Gene Symbol: MAGI3
• Gene ID (NCBI): 260425
• RRID: AB_3669402
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5TCQ9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAGI proteins are scaffolding proteins, belonging to the Membrane-Associated Guanylate Kinase Inverted proteins of the MAGUK family. There are three members of the MAGI subfamily, MAGI-1, MAGI-2, and MAGI-3. They are comprised of 6 PDZ domains, 2 WW domains, and 1 GUK domain. They have been proven to mediate the transport and signal transduction of various G protein-coupled receptors (GPCRs) (PMID: 29625175). The antibody is specific to MAGI3.