MAK Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MAK Polyclonal antibody, PBS Only (13638-1-PBS)

• 

  WB analysis using 13638-1-AP (same clone as 13638-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13638-1-AP (MAK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13638-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 13638-1-AP (same clone as 13638-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13638-1-AP (MAK antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13638-1-PBS in a different storage buffer formulation.

MAK Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13638-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.11.1, Male germ cell-associated kinase, Serine/threonine-protein kinase MAK

---

Product Information

13638-1-PBS targets MAK in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4571

  Product name: Recombinant human MAK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-291 aa of BC039825

  Sequence: MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHANVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYMLRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCVPINLKTLIPNASNEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLG

• Full Name: male germ cell-associated kinase
• Calculated Molecular Weight: 623 aa, 71 kDa
• Observed Molecular Weight: 60-62 kDa
• GenBank Accession Number: BC039825
• Gene Symbol: MAK
• Gene ID (NCBI): 4117
• RRID: AB_10598167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20794
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.