MAN1B1 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 68121-1-Ig (same clone as 68121-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 68121-1-Ig (MAN1B1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68121-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68121-1-Ig (same clone as 68121-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68121-1-Ig (MAN1B1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68121-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68121-1-Ig (same clone as 68121-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68121-1-Ig (MAN1B1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68121-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 68121-1-Ig (same clone as 68121-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using MAN1B1 antibody (68121-1-Ig, Clone: 3C9F10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68121-1-PBS in a different storage buffer formulation.

MAN1B1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68121-1-PBS

Clone No.3C9F10

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ER alpha 1,2 mannosidase, ER mannosidase 1, ERMan1, MAN1B1, MANA ER

---

Product Information

68121-1-PBS targets MAN1B1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28302

  Product name: Recombinant human MAN1B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 350-699 aa of BC002953

  Sequence: LFLRKAEDFGNRLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEAVEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA

• Full Name: mannosidase, alpha, class 1B, member 1
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC002953
• Gene Symbol: MAN1B1
• Gene ID (NCBI): 11253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UKM7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAN1B1, also known as ERMAN1, MANA-ER, belongs to the glycosyl hydrolase 47 family. MAN1B1 is involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation, specifically converting Man9GlcNAc to Man8GlcNAc isomer B. At high enzyme concentrations, it further trims the carbohydrates to Man5-6GlcNAc2 (PMID: 18003979). Mutations in MAN1B1 cause autosomal-recessive intellectual disability. This gene has been associated with Rafiq syndrome (PMID: 21763484).