MAN2B2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MAN2B2 Polyclonal antibody, PBS Only (17697-1-PBS)

• 

  WB analysis of mouse testis using 17697-1-AP (same clone as 17697-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17697-1-AP (MAN2B2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17697-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 17697-1-AP (same clone as 17697-1-PBS)

  WB result of MAN2B2 antibody (17697-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-MAN2B2 transfected NIH/3T3 cells. This data was developed using the same antibody clone with 17697-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 17697-1-AP (same clone as 17697-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 17697-1-AP (MAN2B2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17697-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MAN2B2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17697-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Alpha-1,6-mannosidase, EC:3.2.1.24, Epididymis-specific alpha-mannosidase, KIAA0935

---

Product Information

17697-1-PBS targets MAN2B2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11952

  Product name: Recombinant human MAN2B2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 660-1009 aa of BC033307

  Sequence: VTEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQAGPLELNREAVLRTSTNLNSQQVIYSDNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSRLVLLSERAHGISSQGNGQVEVMLHRRLWNNFDWDLGYNLTLNDTSVVHPVLWLLLGSWSLTTALRQRSALALQHRPVVLFGDLAGTAPKLPGPQQQEAVTLPPNLHLQILSIPGWRYSSNHTEHSQNLRKGHRGEAQADLRRVLLRLYHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGTWDLSMLHRWSWRTGPGRHRGDTTSPSRPPGGPIITVHPKEIRTFFIHFQQQ

• Full Name: mannosidase, alpha, class 2B, member 2
• Calculated Molecular Weight: 1009 aa, 114 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC033307
• Gene Symbol: MAN2B2
• Gene ID (NCBI): 23324
• RRID: AB_2139566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2E5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.