Filter: AllIHCIF/ICC

IHC staining of human brain using 16028-1-AP (same clone as 16028-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 16028-1-AP (MANBAL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16028-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 16028-1-AP (same clone as 16028-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 16028-1-AP (MANBAL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16028-1-PBS in a different storage buffer formulation.
IF Staining of U2OS using 16028-1-AP (same clone as 16028-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MANBAL antibody (16028-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16028-1-PBS in a different storage buffer formulation.

MANBAL Polyclonal antibody, PBS Only

Name: MANBAL Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 16028-1-PBS

MANBAL Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 16028-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

16028-1-PBS targets MANBAL in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8888 Product name: Recombinant human MANBAL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-85 aa of BC014672 Sequence: MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR Predict reactive species
Full Name	mannosidase, beta A, lysosomal-like
Calculated Molecular Weight	85 aa, 10 kDa
GenBank Accession Number	BC014672
Gene Symbol	MANBAL
Gene ID (NCBI)	63905
RRID	AB_2139582
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NQG1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™