Tested Applications
| Positive IF/ICC detected in | Chloroquine treated NIH/3T3 cells, Chloroquine treated HeLa cells, Chloroquine treated PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IF | See 4 publications below |
Product Information
66139-3-Ig targets LC3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17959 Product name: Recombinant human MAP1LC3A,LC3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-121 aa of BC015810 Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF Predict reactive species |
| Full Name | microtubule-associated protein 1 light chain 3 alpha |
| Calculated Molecular Weight | 121 aa, 14 kDa |
| GenBank Accession Number | BC015810 |
| Gene Symbol | LC3 |
| Gene ID (NCBI) | 84557 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9H492 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LC3A, also named as MAP1LC3A, LC3, MAP1ALC3 and MAP1BLC3, belongs to the MAP1 LC3 family. LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B, which are microtubule-associated proteins that mediate the physical interactions between microtubules and components of the cytoskeleton. In cell biology, autophagy, or autophagocytosis, is a catabolic process involving the degradation of a cell's components through the lysosomalmachinery. It is a major mechanism by which a starving cell reallocates nutrients from unnecessary processes to more-essential processes. Two forms of LC3, called LC3-I (17-19kd) and -II(14-16kd), were produced post-translationally in various cells. LC3-I is cytosolic, whereas LC3-II is membrane bound. The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II. The amount of LC3-II is correlated with the extent of autophagosome formation. LC3-II is the first mammalian protein identified that specifically associates with autophagosome membranes. (PMID:11060023) MAP1LC3 has 3 isoforms MAP1LC3A, MAP1LC3B and MAP1LC3C. MAP1LC3A and MAP1LC3C are produced by the proteolytic cleavage after the conserved C-terminal Gly residue, like their rat counterpart, MAP1LC3B does not undergo C-terminal cleavage and exists in a single modified form.(PMID:12740394 )
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LC3 antibody 66139-3-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
JCI Insight Deletion of SH2D5 alleviates epileptic seizures and NMDAR expression via autophagic degradation of STAT1.
| ||
Free Radic Biol Med Optineurin enhances the chemoresistance by activating mitophagy in acute myeloid leukemia with NPM1 mutation. | ||
Front Immunol Comprehensive analysis of IGFL1 in colorectal cancer and its promotion of tumour progression via inhibition of lipophagy. | ||
Mol Divers A multifunctional 5-fluorouracil prodrug: synthesis, biological evaluation, and antitumor mechanism investigation. |





