LC3 Monoclonal antibody

LC3 Monoclonal Antibody for IF/ICC, ELISA
Cat No. 66139-3-Ig
Clone No.2A5E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, ELISA

MAP1LC3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, LC3A, MAP1 light chain 3-like protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inChloroquine treated NIH/3T3 cells, Chloroquine treated HeLa cells, Chloroquine treated PC-12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66139-3-Ig targets LC3 in IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17959

Product name: Recombinant human MAP1LC3A,LC3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-121 aa of BC015810

Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

Predict reactive species
Full Name microtubule-associated protein 1 light chain 3 alpha
Calculated Molecular Weight 121 aa, 14 kDa
GenBank Accession NumberBC015810
Gene Symbol LC3
Gene ID (NCBI) 84557
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H492
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LC3A, also named as MAP1LC3A, LC3, MAP1ALC3 and MAP1BLC3, belongs to the MAP1 LC3 family. LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B, which are microtubule-associated proteins that mediate the physical interactions between microtubules and components of the cytoskeleton. In cell biology, autophagy, or autophagocytosis, is a catabolic process involving the degradation of a cell's components through the lysosomalmachinery. It is a major mechanism by which a starving cell reallocates nutrients from unnecessary processes to more-essential processes. Two forms of LC3, called LC3-I (17-19kd) and -II(14-16kd), were produced post-translationally in various cells. LC3-I is cytosolic, whereas LC3-II is membrane bound. The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II. The amount of LC3-II is correlated with the extent of autophagosome formation. LC3-II is the first mammalian protein identified that specifically associates with autophagosome membranes. (PMID:11060023) MAP1LC3 has 3 isoforms MAP1LC3A, MAP1LC3B and MAP1LC3C. MAP1LC3A and MAP1LC3C are produced by the proteolytic cleavage after the conserved C-terminal Gly residue, like their rat counterpart, MAP1LC3B does not undergo C-terminal cleavage and exists in a single modified form.(PMID:12740394 )

Protocols

Product Specific Protocols
IF protocol for LC3 antibody 66139-3-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...