MAP1LC3A,LC3 Monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• MAP1LC3A,LC3 Monoclonal antibody, PBS Only (Capture) (66139-4-PBS)

MAP1LC3A,LC3 Monoclonal Antibody for Cytometric bead array, Indirect ELISA, Sample test

Cat No. 66139-4-PBS

Clone No.1B5H5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Synonyms

LC3, MAP1LC3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, LC3A

• 

  Sample test of MP51371-1

  Sample test of MP51371-1, MAP1LC3A,LC3 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66139-4-PBS. Detection antibody: 66139-5-PBS.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP51371-1

  Cytometric bead array standard curve of MP51371-1, MAP1LC3A,LC3 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66139-4-PBS. Detection antibody: 66139-5-PBS. Standard:Ag17959. Range: 0.391-400 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

66139-4-PBS targets MAP1LC3A,LC3 as part of a matched antibody pair:

MP51371-1: 66139-4-PBS capture and 66139-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17959

  Product name: Recombinant human MAP1LC3A,LC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-121 aa of BC015810

  Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

• Full Name: microtubule-associated protein 1 light chain 3 alpha
• Calculated Molecular Weight: 121 aa, 14 kDa
• GenBank Accession Number: BC015810
• Gene Symbol: LC3
• Gene ID (NCBI): 84557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H492
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.