MAP2 Monoclonal antibody

MAP2 Monoclonal Antibody for IHC, IF-P, IF-Fro, FC (Intra), ELISA
Cat No. 67015-1-Ig
Clone No.1C3E6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA

1C3E6, MAP 2, MAP-2, MAP2A, MAP2B

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue, rat cerebellum tissue, rat brain tissue, human brain tissue, mouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue, mouse brain tissue
Positive IF-Fro detected inrat brain tissue, mouse brain tissue
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67015-1-Ig targets MAP2 in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11349

Product name: Recombinant human MAP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 213-559 aa of BC038857

Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL

Predict reactive species
Full Name microtubule-associated protein 2
Calculated Molecular Weight 200 kDa
GenBank Accession NumberBC038857
Gene Symbol MAP2
Gene ID (NCBI) 4133
RRIDAB_2882331
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11137
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in brain and has important role in neuronal morphogenesis. Multiple high molecular weight (MW) and low molecular weight (MW) MAP2 isoforms are expressed within axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally specific manner. MAP2 antibodies have been widely used to mark the neuron or dendrite formation.

Protocols

Product Specific Protocols
IHC protocol for MAP2 antibody 67015-1-IgDownload protocol
IF protocol for MAP2 antibody 67015-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell

Revisiting astrocyte to neuron conversion with lineage tracing in vivo.

Authors - Lei-Lei Wang
mouseIF

Cell Stem Cell

In vivo reprogramming of NG2 glia enables adult neurogenesis and functional recovery following spinal cord injury.

Authors - Wenjiao Tai
mouseIF

Nat Chem Biol

Tracking endogenous proteins based on RNA editing-mediated genetic code expansion

Authors - Min Hao
ratIF

Small

Stemness Maintenance and Massproduction of Neural Stem Cells on Poly L-Lactic Acid Nanofibrous Membrane Based on Piezoelectriceffect.

Authors - Xiheng Lu
ratIF

Cell Death Dis

ChemR23 activation attenuates cognitive impairment in chronic cerebral hypoperfusion by inhibiting NLRP3 inflammasome-induced neuronal pyroptosis

Authors - Yaxuan Zhang
mouseWB,IF

Cell Death Dis

Pyruvate dehydrogenase kinase 1 protects against neuronal injury and memory loss in mouse models of diabetes

Authors - Yuan Yao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marion (Verified Customer) (03-11-2025)

Very good product

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/800
  • Cell Tissue Type: Brain (mouse)
MAP2 Antibody Immunofluorescence validation (1/800 dilution) in Brain (mouse) (Cat no:67015-1-Ig)
FH

Marianne (Verified Customer) (11-24-2024)

good

  • Applications: Western Blot, Immunohistochemistry
  • Cell Tissue Type: neurons
FH

Alessandro (Verified Customer) (12-09-2023)

good IF antibody. no unspecific staining

  • Applications: Immunofluorescence
  • Cell Tissue Type: Cortical organoids
FH

Azita (Verified Customer) (05-31-2021)

Human primary cortical cells went trough ICC and the MAP2 antibody at the 1/1000 dilution was used overnight at 4°C.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Human primary cortical cells
MAP2 Antibody Immunohistochemistry validation (1/1000 dilution) in Human primary cortical cells (Cat no:67015-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...