CoraLite® Plus 488-conjugated MAP2 Polyclonal antibody

MAP2 Polyclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-17490

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

MAP 2, MAP-2, MAP2A, MAP2B, MAP2C

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inrat brain tissue
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17490 targets MAP2 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11580

Product name: Recombinant human MAP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 213-559 aa of BC038857

Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL

Predict reactive species
Full Name microtubule-associated protein 2
Calculated Molecular Weight 200 kDa
Observed Molecular Weight
GenBank Accession NumberBC038857
Gene Symbol MAP2
Gene ID (NCBI) 4133
RRIDAB_2919149
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP11137
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Microtubule-associated protein 2 (MAP2) is a tubulin binding protein regulating the spacing and stability of microtubules and contributing to elongation of dendrites.

What is the molecular weight of MAP2? Is MAP2 post-translationally modified?

MAP2 has multiple isoforms that arise from alternative splicing (PMID: 3121794, 7854050, and 10383434). They are classified into two groups - MAP2A and MAP2B, which are known as high molecular weight (HMW) isoforms, run as ~280 kDa species, while low molecular weight (LMW) isoforms MAP2C and MAP2D are around ~70 kDa. MAP2 proteins are heavily phosphorylated, which contributes to a large discrepancy between their predicted and observed molecular weight in SDS-PAGE (220 vs 280 kDa for HMW forms).

What is the tissue expression pattern of MAP2? What is the subcellular localization of MAP2?

MAP2 isoforms differ in their tissue and developmental expression pattern (PMID: 2469170 and 3898077). In the brain, MAP2B is widely expressed during and post development, MAP2A is expressed postnatally, while MAP2C is present only in the early development except of present in photosensitive cells of the adult retina and in the olfactory system. MAP proteins are highly expressed in the CNS found in cell bodies and dendrites of neurons, in dorsal root ganglion, reactive glia, and in the testis (PMID: 9588626). In neurons, MAP2 proteins are found in the cell body and dendrites, where they associate with microtubules, while they can also be present in the nuclei of testicular cells.

Can MAP2 be used as a neuronal marker?

MAP2 proteins are abundantly expressed in neurons. MAP2 is frequently used as a dendritic marker because it is present in the cell body and dendrites of neurons but absent in axons (PMID: 28413822).


Protocols

Product Specific Protocols
FC protocol for CL Plus 488 MAP2 antibody CL488-17490Download protocol
IF protocol for CL Plus 488 MAP2 antibody CL488-17490Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

Antioxidants (Basel)

Cellular Localization of Kynurenine 3-Monooxygenase in the Brain: Challenging the Dogma.

Authors - Korrapati V Sathyasaikumar
Loading...
||
New chat

Able

正在加载,请稍候...