MAP2K3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MAP2K3 Polyclonal antibody (13898-1-AP)

• Featured Product
• KD/KO Validated

MAP2K3 Polyclonal Antibody for WB, ELISA

Cat No. 13898-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

MEK3, Dual specificity mitogen-activated protein kinase kinase 3, EC:2.7.12.2, MAP kinase kinase 3, MAPK/ERK kinase 3

• 

  WB analysis using 13898-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13898-1-AP (MAP2K3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13898-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13898-1-AP (MAP2K3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MAP2K3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, mouse skeletal muscle tissue, A549 cells, THP-1 cells, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13898-1-AP targets MAP2K3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4861

  Product name: Recombinant human MAP2K3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-347 aa of BC032478

  Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

• Full Name: mitogen-activated protein kinase kinase 3
• Calculated Molecular Weight: 347 aa, 39 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC032478
• Gene Symbol: MAP2K3
• Gene ID (NCBI): 5606
• RRID: AB_10642959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46734
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAP2K3, also named MKK3, is a member of the dual specificity kinase group and serves as a specific activator of p38 MAPK with MKK6. MKK3 can be phosphorylated by cytokines and environmental stress at sites Ser189 and Thr193 by MKKK proteins (MEKK 1-4). MKK3 plays a key role in cell differentiation, motility, division, and death. It has been reported that MKK3 targeting may represent an effective and potentially safe therapeutic strategy to selectively kill cancer cells in colorectal cancer patients. (PMID: 31695024, 30770795, 26805700, 8622669)

Publications

What published studies show

MAP2K3 (MKK3) Polyclonal Antibody (Cat# 13898-1-AP) has 10 citations across journals including Acta Pharmacologica Sinica, International Journal of Molecular Medicine, Biomedicine & Pharmacotherapy, Cell & Molecular Life Sciences, Biochemical Pharmacology, Food & Function, Scientific Reports, Molecular Immunology, PLoS ONE, and Bioengineered. Research fields span gastric and lung cancer, oxidative stress, inflammation, cell migration, apoptosis, proteostasis, urate reabsorption, and liver fibrosis, all centered on the MKK3/p38 MAPK signaling pathway.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Acta Pharmacol Sin; Targeting PRSS23 with tipranavir induces gastric cancer stem cell apoptosis and inhibits growth of gastric cancer via the MKK3/p38 MAPK-IL24 pathway; Authors - Ji-Xian Xiong ; KD Validated
rat	WB	Int J Mol Med; Protective effects of CXCR3/HO‑1 gene‑modified BMMSCs on damaged intestinal epithelial cells: Role of the p38‑MAPK signaling pathway.; Authors - Mingli Yin
human	WB	Biomed Pharmacother; Identification of MAP Kinase Kinase 3 as a protein target of myricetin in non-small cell lung cancer cells; Authors - Ling Gu ; KD Validated
		Biochem Pharmacol; Sodium butyrate upregulates URAT1-mediated urate reabsorption in HK2 cells by activating FFAR2/p38 MAPK/ELK1/ARRB2 axis and relieving NF-κB-HNF1β competitive binding.; Authors - Cheng Cao
human	WB	Cell Mol Life Sci; HERC2 deficiency activates C-RAF/MKK3/p38 signalling pathway altering the cellular response to oxidative stress; Authors - Joan Sala-Gaston
mouse	WB	Food Funct; L-Theanine mediates the p38MAPK signaling pathway to alleviate heat-induced oxidative stress and inflammation in mice.; Authors - Kehong Liu