MAP3K4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MAP3K4 Polyclonal antibody, PBS Only (21610-1-PBS)

• 

  WB analysis of K-562 using 21610-1-AP (same clone as 21610-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 21610-1-AP (MAP3K4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21610-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 21610-1-AP (same clone as 21610-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 21610-1-AP (MAP3K4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21610-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 21610-1-AP (same clone as 21610-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using MAP3K4 antibody (21610-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21610-1-PBS in a different storage buffer formulation.

MAP3K4 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 21610-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:2.7.11.25, KIAA0213, MAP three kinase 1, MAPK/ERK kinase kinase 4, MAPKKK4

---

Product Information

21610-1-PBS targets MAP3K4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16254

  Product name: Recombinant human MAP3K4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 825-1174 aa of BC146770

  Sequence: DLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQQSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGLYLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGF

• Full Name: mitogen-activated protein kinase kinase kinase 4
• Calculated Molecular Weight: 1608 aa, 182 kDa
• Observed Molecular Weight: 170-180 kDa
• GenBank Accession Number: BC146770
• Gene Symbol: MAP3K4
• Gene ID (NCBI): 4216
• RRID: AB_10804775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6R4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.